PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.014G104800.1
Common NamePOPTR_0014s10060g, PtVNS09, WND2A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 383aa    MW: 43782.8 Da    PI: 6.4363
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.014G104800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62.1e-52151431128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eel+++yL+kkv+ +k++l +vi++vd++k+ePwd+++++k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+
  Potri.014G104800.1  15 VPPGFRFHPTEEELLHYYLRKKVSYEKIDL-DVIRDVDLNKLEPWDIQERCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGR 104
                         69****************************.9***************964444122455******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk ++s +g+ +g++ktLvfykgrap+g+k+dW+mheyrl
  Potri.014G104800.1 105 DKVIYS-TGKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                         ******.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-599174IPR003441NAC domain
PROSITE profilePS5100557.13615174IPR003441NAC domain
PfamPF023651.6E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MTENMSISVN GQSQVPPGFR FHPTEEELLH YYLRKKVSYE KIDLDVIRDV DLNKLEPWDI  60
QERCKIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS TGKRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDSTSDT NVSNVMEEEA AQEEGWVVCR IFKKKNLNKT  180
LDKPFSSSPI SADTRNQMLS SCDEGTIDQT FHYMGRTCKE ENVADNSATA RYLRPVDTAI  240
NYVHHDGFMK LPSLESPNSI SSQNCYQPMI TDNEGSITNQ MSYPLDPGLD NWATLDRLFA  300
YQLNGQTETS RQLPCIDPTI TYCTPSTDLH HDLRLPTLRS SFPLPSNRSY HGTQDYNNEI  360
DLWNFTTRSS PDTLCQLSNT GA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-4991769170Stress-induced transcription factor NAC1
Search in ModeBase
Function -- GeneRIF ? help Back to Top
  1. Authors overexpressed Secondary Wall-Associated NAC Domain 1s (Ptr-SND1-B1), a TF gene affecting wood formation, in stem differentiating xylem protoplasts and identified differentially expressed genes by RNA sequencing.
    [PMID: 24280390]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999400.0AB599940.1 Populus trichocarpa PtVNS09 mRNA for transcription factor, complete cds.
GenBankHQ2158490.0HQ215849.1 Populus trichocarpa wood-associated NAC domain transcription factor 2A (WND2A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320897.20.0no apical meristem family protein
SwissprotQ84WP61e-142NAC43_ARATH; NAC domain-containing protein 43
TrEMBLE5KUH30.0E5KUH3_POPTR; No apical meristem family protein
STRINGPOPTR_0014s10060.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-132NAC family protein
Publications ? help Back to Top
  1. Zhong R,Lee C,Ye ZH
    Functional characterization of poplar wood-associated NAC domain transcription factors.
    Plant Physiol., 2010. 152(2): p. 1044-55
    [PMID:19965968]
  2. Ohtani M, et al.
    A NAC domain protein family contributing to the regulation of wood formation in poplar.
    Plant J., 2011. 67(3): p. 499-512
    [PMID:21649762]
  3. Lin YC, et al.
    SND1 transcription factor-directed quantitative functional hierarchical genetic regulatory network in wood formation in Populus trichocarpa.
    Plant Cell, 2013. 25(11): p. 4324-41
    [PMID:24280390]
  4. Zhao Y,Sun J,Xu P,Zhang R,Li L
    Intron-mediated alternative splicing of WOOD-ASSOCIATED NAC TRANSCRIPTION FACTOR1B regulates cell wall thickening during fiber development in Populus species.
    Plant Physiol., 2014. 164(2): p. 765-76
    [PMID:24394777]